PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A06G0676
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 329aa    MW: 37066.5 Da    PI: 8.4105
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A06G0676genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.37.5e-081445132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     rg+WT+ Ed++l+d++k +G g+W+  +++ g
      Gh_A06G0676 14 RGAWTALEDKILKDYIKVHGEGRWRNLPKRAG 45
                     89***********************9999987 PP

2Myb_DNA-binding544e-1794138147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ +++E+el+++++k+lG++ W++Ia +++ gRt++++k++w++ 
      Gh_A06G0676  94 RGNISPDEEELIIKLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 138
                      7899******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.7E-21591IPR009057Homeodomain-like
PROSITE profilePS500909.349988IPR017877Myb-like domain
SuperFamilySSF466895.3E-9948IPR009057Homeodomain-like
SMARTSM007172.6E-91390IPR001005SANT/Myb domain
CDDcd001679.87E-71688No hitNo description
SuperFamilySSF466895.64E-2074145IPR009057Homeodomain-like
SuperFamilySSF466895.3E-97592IPR009057Homeodomain-like
PROSITE profilePS5129425.84489143IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.8E-2592142IPR009057Homeodomain-like
SMARTSM007171.9E-1693141IPR001005SANT/Myb domain
PfamPF002493.4E-1594139IPR001005SANT/Myb domain
CDDcd001672.61E-1298139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGRSPCCSKE GLNRGAWTAL EDKILKDYIK VHGEGRWRNL PKRAGLYNFN TNFYIFLFPS  60
KNKHYPNMSF IGLKRCGKSC RLRWLNYLRP DIKRGNISPD EEELIIKLHK LLGNRWSLIA  120
GRLPGRTDNE IKNYWNTNLS KRVSDRQKSP AAPSKNPEAA RRGTAGNGNT NGNGSGSSST  180
HVVRTRATRC SKVFINPPHY TQNRDPKPSS TCSNHGDHRE PKTMNELLLP IMSESENEGT  240
TDHISSDFTF DFNMGEFCLS DLLNSDFCDV NELNYSNGFD SSPSPDQPPM DFSDEMLKEW  300
TAAASTHCCH QSAASNLQSL PPFIENGIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-211214325128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.80790.0boll| ovule
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO133461850.0
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3362820.0AF336282.1 Gossypium hirsutum GHMYB10 (ghmyb10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012452654.10.0PREDICTED: transcription factor TT2-like
TrEMBLQ9ATD50.0Q9ATD5_G
STRINGGLYMA13G16890.12e-96(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.14e-49MYB family protein